PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.2G013500.1.p
Common NameLOC101755467, SETIT_030286mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 359aa    MW: 38181.9 Da    PI: 7.9626
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.2G013500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.21.3e-31235290156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r+ W+p+LH++Fv a++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Seita.2G013500.1.p 235 KARRTWSPDLHRQFVAALNQLGGPQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 290
                         68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.084232292IPR017930Myb domain
SuperFamilySSF466892.33E-16233293IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28233293IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-25235290IPR006447Myb domain, plants
PfamPF002498.1E-7237288IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGLDVLEIGM GSDLSLDLRY FASKAVRQAR DAPASDVDAC IRRLEEERGK IEMFRRELPL  60
CARLLAEVID VMKAEAGKKA RSDRKAAAEE DGAAGDKSKW MSTAQLWTGD SGREDDSESE  120
KQDKGRSSPE AKSGGGGAFV PFKAVGSGAP AFAPLCLRVD DKAADAGMPD LSLLSPPAIK  180
SAPAPAGAAE ESRRQVVGFA QAAARAVAMA PSAPSLTLQP QPQQTAQQQQ QQARKARRTW  240
SPDLHRQFVA ALNQLGGPQV ATPKQIRELM KVDGLTNDEV KSHLQKYRLH NRRAPGSAVV  300
SQPIVLVGGL WIPQEQSSSQ SGSPQGPLHF STSGLAVSSA ATVSCEEEDG RSESYGWK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955370.10.0PREDICTED: transcription factor PCL1-like
TrEMBLK3ZUK50.0K3ZUK5_SETIT; Uncharacterized protein
STRINGSi030286m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP181737107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-32G2-like family protein